PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo23G0037800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 237aa    MW: 25488.2 Da    PI: 10.6828
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo23G0037800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding612.5e-191964147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+++Ed +lv++v+++G+++W+ I+  ++ gR++k+c++rw++ 
  Spipo23G0037800 19 KGSWSPDEDARLVELVHRHGPRNWSGISTAIP-GRSGKSCRLRWFNQ 64
                     799*****************************.***********996 PP

2Myb_DNA-binding54.33.1e-1773115347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+ Ed  +v a++++G++ W+tIar ++ gRt++++k++w++ 
  Spipo23G0037800  73 PFTAAEDATIVAAHAMYGNK-WATIARLLP-GRTDNSVKNHWNST 115
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.0171469IPR017930Myb domain
SuperFamilySSF466895.62E-3016112IPR009057Homeodomain-like
SMARTSM007172.4E-151867IPR001005SANT/Myb domain
PfamPF002497.7E-191964IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-232072IPR009057Homeodomain-like
CDDcd001677.58E-142163No hitNo description
SMARTSM007172.1E-1470118IPR001005SANT/Myb domain
PROSITE profilePS5129420.42871120IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-2273119IPR009057Homeodomain-like
CDDcd001675.39E-1173116No hitNo description
PfamPF002493.3E-1473115IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MEVENGVRGG GAGDGRRSKG SWSPDEDARL VELVHRHGPR NWSGISTAIP GRSGKSCRLR  60
WFNQLSPAVE HRPFTAAEDA TIVAAHAMYG NKWATIARLL PGRTDNSVKN HWNSTLRRRR  120
PSESTSQRSP SSAPNSSEQD VSDSDSDSAR KRRCQRGAFM SAGQAPTDLQ REPMTSLSLS  180
PPSRNESAAA TAAAAGGGGG AKKQGSGWEV EEMSLLSIVR EMIAEEVRSY MSRARA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-37191194104MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-361811926127MYB TRANSFORMING PROTEIN
1mse_C8e-37191194104C-Myb DNA-Binding Domain
1msf_C8e-37191194104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010253806.19e-75PREDICTED: transcription factor MYB44-like
TrEMBLA0A0D2RZH72e-72A0A0D2RZH7_G
STRINGVIT_13s0067g01360.t012e-65(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135442731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.14e-49myb domain protein 70